A practical reference on creatinine: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-07-13 and is reviewed periodically as new material appears.
Recommended storage usually involves a sealed container kept at room temperature, away from direct sunlight and moisture. High humidity can cause caking, which changes flow properties and may complicate accurate weighing. Repeated opening of containers exposes the powder to air and moisture, so smaller aliquots can reduce handling effects. Storage temperature ranges are not absolute requirements; they reflect conditions that slow degradation and preserve consistent physical characteristics. Clean, dry tools help prevent contamination during sampling.
Identity and purity are commonly assessed by high-performance liquid chromatography, often with ultraviolet detection, and by spectroscopic techniques such as infrared or nuclear magnetic resonance. These methods can distinguish creatine from creatinine and detect related impurities. Moisture content may be measured by Karl Fischer titration or loss on drying. Particle size, bulk density, and heavy metal limits are additional quality parameters. Not every product is tested by every method, so specifications depend on the intended use and regulatory framework.
Solid creatine monohydrate is generally stable when kept dry and protected from extremes of heat and humidity. In the presence of moisture, it can gradually convert to creatinine, a cyclic dehydration product that has little value for phosphocreatine synthesis. Elevated temperatures and acidic conditions accelerate this conversion in solution. Because the reaction is slow in cool, dry storage, typical shelf lives are measured in years rather than weeks. Packaging that limits moisture and oxygen exposure helps maintain purity.
The term creatine monohydrate is often shortened to creatine in casual usage, though other creatine forms exist, including citrate, nitrate, and hydrochloride salts. These alternative forms differ in solubility, pH behavior, and the amount of creatine delivered per unit mass. Regulatory categories vary by country: some jurisdictions treat it as a food ingredient, while others place it under supplement or drug frameworks depending on claims and presentation. Standard reference texts list it as a naturally occurring nitrogenous organic acid rather than a vitamin or mineral.
Creatine monohydrate is a crystalline organic compound formed from creatine and water in a one-to-one ratio. It belongs to the guanidino family and contains a methylated guanidine group attached to an acetate-like chain. The solid is commonly described as a white, odorless powder with a mildly bitter taste. Its molecular formula is C4H11N3O3·H2O, and the hydrated form is the most widely traded grade. The compound occurs naturally in vertebrate muscle and brain tissue, where it participates in rapid energy buffering.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | 15–25 °C | Cool, dry, sealed conditions slow conversion to creatinine. |
| Moisture sensitivity | Moderate | Absorbs water from humid air, which can cause caking. |
| Primary purity method | HPLC-UV | Separates creatine from creatinine and related impurities. |
| Moisture method | Karl Fischer titration | Measures water content; loss on drying is an alternative. |
| Degradation product | Creatinine | Forms by dehydration, especially in solution or humid heat. |
Storage recommendations generally emphasize a cool, dry place away from direct sunlight and strong oxidizers. Sealed containers limit humidity exchange, which helps prevent clumping and gradual conversion to creatinine. Long-term stability studies usually monitor appearance, moisture, and purity at intervals under defined temperature and humidity conditions. Accelerated tests at elevated temperature can reveal degradation pathways, but they do not perfectly predict room-temperature shelf life. Questions remain about how much creatinine formation is acceptable in different product categories and how packaging choices affect that rate over time.
Commercial creatine monohydrate is typically manufactured through chemical synthesis, often starting from sarcosine and cyanamide. The resulting material is crystallized, washed, and dried to a specified hydrate content. Finished lots are tested for identity, purity, moisture, and heavy metals before release. Because the compound can cyclize to creatinine under heat or prolonged storage in solution, manufacturers control temperature and humidity during processing. The solid itself is relatively stable when kept dry and sealed, but moisture uptake can cause caking and complicate accurate assay.
Regulatory status varies by country. In the United States, creatine monohydrate is sold as a dietary supplement ingredient, while in the European Union it is placed on the market as a food supplement component. Some jurisdictions have established purity monographs or permitted health claims, while others treat it as a novel food or require notification. Product labels may state the amount of creatine monohydrate or the equivalent creatine content, and the two figures can differ. Independent testing programs sometimes check identity, potency, and contaminant limits.
Creatine monohydrate is stable under dry, cool conditions but can degrade when exposed to moisture and heat. In solution, it undergoes hydrolysis to creatinine, a cyclic derivative with little role in phosphagen energy transfer. The rate of conversion increases with temperature, storage time, and acidic or alkaline pH. Solid material kept in a sealed container at room temperature generally retains its composition for extended periods. Moisture uptake is a primary concern because it can accelerate breakdown and caking.
Analytical laboratories commonly use high-performance liquid chromatography to separate creatine from creatinine and related impurities. Ion chromatography, nuclear magnetic resonance, and titration assays can also quantify the compound. Water content is measured by Karl Fischer titration or loss on drying, because the monohydrate has a defined theoretical water fraction. Particle size, bulk density, and flowability are physical properties that affect blending and capsule filling. These measurements support quality control and help verify that a lot matches its specification.
The compound was identified in the nineteenth century after chemists isolated a nitrogenous substance from meat extracts. Later work established its role in muscle energy metabolism and its conversion to phosphocreatine. Chemical synthesis of creatine followed, and industrial production made the monohydrate widely available as a purified powder. Interest expanded in the late twentieth century when researchers began studying creatine supplementation and muscle physiology. Historical accounts sometimes differ on exact dates and attributions, but the broad sequence from tissue extracts to synthetic production is well documented.
In the body, creatine is obtained from dietary meat and fish and is also synthesized from arginine, glycine, and methionine. Muscle stores creatine and phosphocreatine, which participate in the rapid regeneration of adenosine triphosphate during short, intense activity. The monohydrate form is used in research because it is chemically defined, stable as a dry solid, and relatively inexpensive to produce. Questions remain about whether other creatine forms offer meaningful advantages in absorption or tissue retention, and findings vary across studies and populations.
Creatine monohydrate is a crystalline compound formed from creatine and one molecule of water. Creatine itself is a nitrogen-containing organic acid that occurs in vertebrate muscle and other tissues. The monohydrate designation refers to the water included in the crystal lattice, not to water added during manufacturing. Its chemical formula is commonly written as C4H9N3O2·H2O. The solid is typically a white, odorless powder with low solubility in water at room temperature. It is one of several creatine forms described in scientific and commercial literature.
Commercial creatine monohydrate is produced mainly by chemical synthesis rather than extraction from animal tissue. Suppliers provide a certificate of analysis listing assay, water content, and impurity limits, and some products undergo third-party testing. Verification of identity can use infrared or Raman spectroscopy alongside chromatographic methods. Storage recommendations generally call for a cool, dry place and a tightly closed container to limit moisture uptake. Open questions include how packaging, flavoring agents, and long-term storage affect the stability of finished products.
Dry creatine monohydrate is generally stable when kept sealed and protected from heat and moisture. In solution, however, creatine undergoes a slow cyclization to creatinine, a related compound with no role in phosphocreatine storage. The rate of this conversion increases with temperature and is influenced by pH. Because creatinine is a common impurity in liquid or poorly stored products, analytical testing often measures both compounds. The crystalline monohydrate is less prone to degradation than aqueous preparations, though caking can occur if moisture enters the container.
== Bibliography == Barkawi, Tarak (April 2006). "Culture and Combat in the Colonies: The Indian Army In the Second World War". Journal of Contemporary History. 41 (2). Sage: 325–355. doi:10.1177/0022009406062071. S2CID 145364543. Barthorp, Michael (2002). Afghan Wars and the North-West Frontier 1839–1947. London: Cassel. ISBN 0-304-36294-8. Barua, Pradeep (2003). Gentlemen of the Raj: The Indian Army Officer Corps, 1817–1949. Westport, CT: Praegar. ISBN 0275979997. Chandler, David (2002). Oxford History of the British Army (2nd ed.). USA: Oxford University Press. ISBN 0192803115. Gaylor, John (1996). Sons of John Company – The Indian & Pakistan Armies 1903–1991. Tunbridge Wells, Kent: Parapress. ISBN 1-898594-41-4. Haythornthwaite, P.J. (1992). The World War One Sourcebook. Arms and Armour Press. Heathcote, T. A. (1974). The Indian Army – The Garrison of British Imperial India, 1822–1922. Newton Abbot, Devon: David & Charles. Ilbert, Courtenay (1 January 1913). "British India". Journal of the Society of Comparative Legislation. 13 (2): 327–333. JSTOR 752287. Imperial Gazetteer of India, Volume IV (1908). Indian Empire: Administrative. Oxford: Clarendon Press. p. 552. Jackson, Donovan (1940). India's Army. London: Sampson Low. Lapping, Brian (1985). End of Empire. London: Guild Publishing. Mazumder, Rajit K. (2003). The Indian army and the making of Punjab. Delhi, India: Permanent Black. ISBN 8178240599. Nathan, R.; Lee-Warner, William; Carnduff, H. W. C.; Maclagan, E. D.; Walker, G. H. D.; Collen, Edwin; Nathan; Bythel, W. J.; Hemming, T. H. (1908).
Ancient Egyptians might have farmed fish (especially gilt-head bream) from Lake Bardawil about 1,500 BCE (about 3,500 BP), and they traded them with Canaan. Gim cultivation is the oldest aquaculture in Korea. Early cultivation methods used bamboo or oak sticks; newer methods utilizing nets replaced them in the 19th century. Floating rafts have been used for mass production since the 1920s. Japanese people cultivated seaweed by providing bamboo poles and, later, nets and oyster shells to serve as anchoring-surfaces for spores. Romans bred fish in ponds and farmed oysters in coastal lagoons before 100 CE.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
The arapaima, pirarucu, or paiche is a large species of bonytongue in the genus Arapaima native to the Amazon and Essequibo basins of South America. Arapaima is the type genus of the subfamily Arapaiminae within the family Osteoglossidae. They are among the world's largest freshwater fish, reaching as much as 3 m (9.8 ft) in length. They are an important food fish. They have declined in the native range due to overfishing and habitat loss. In contrast, arapaima have been introduced to several tropical regions outside the native range (within South America and elsewhere), where they are sometimes considered invasive species. In Kerala, India, arapaima escaped from aquaculture ponds after floods in 2018. Its Portuguese name, pirarucu, derives from the Tupi language words pira and urucum, meaning "red fish". Arapaima was traditionally regarded as a monotypic genus, but later, several species were distinguished. As a consequence of this taxonomic confusion, most earlier studies were done using the name A. gigas, but this species is only known from old museum specimens and the exact native range is unclear. The regularly seen and studied species is A. arapaima, although a small number of A. leptosoma also have been recorded in the aquarium trade. The remaining species are virtually unknown: A. agassizii from old detailed drawings (the type specimen itself was lost during World War II bombings) and A. mapae from the type specimen.
The company's primary competitors for its hardware are Nvidia, AMD, Intel, and Broadcom and the company's primary competitors for its cloud computing services are Amazon Web Services, Microsoft Azure, Google Cloud Platform, Oracle Corporation, and CoreWeave.
Sources: en.wikipedia.org
With Muir gone, the remaining members continued as a four-piece, releasing Starless and Bible Black in March 1974. Earning a positive Rolling Stone review, most of the album was recorded live during the band's late 1973 tour, with the recordings carefully edited and overdubbed to sound like studio recordings, while "The Great Deceiver", "Lament" and the second half of "The Night Watch" were recorded entirely in the studio. The album reached No. 28 in the UK and No. 64 in the US. Following the album's release, the band began to divide once more, this time over performance. Musically, Fripp found himself positioned between Bruford and Wetton, who played with such force and increasing volume that Fripp once compared them to "a flying brick wall", and Cross, whose amplified acoustic violin was consistently drowned out by the rhythm section, leading him to concentrate more on keyboards. An increasingly frustrated Cross began to withdraw both musically and personally, with the result being that he was voted out of the group following the band's 1974 tour.
=== Dextran-crosslinked microspheres === One application of the glucose polymer dextran in microsphere compositions is as a cross-linker. Dextran and oxidized dextran can be used to crosslink gelatin microspheres to reduce gelatin dissolution, which slows the drug release rate. These dextran/gelatin microspheres can be used to provide slow-release of TRAPP-Br, which is a cancer therapeutic. Hydrogel microspheres synthesized by using porous chitosan polyelectrolyte complex with dextran sulfate as a cross-linker can deliver hydrophobic drugs to the intestines with high efficacy.
== Concerns == Concerns over AI agents include potential issues of liability, an increased risk of cybercrime, ethical challenges, and problems related to AI safety and AI alignment. Other issues involve data privacy, weakened human oversight, a lack of guaranteed repeatability, reward hacking, algorithmic bias, compounding software errors, lack of explainability of agents' decisions, security vulnerabilities, stifling competition, problems with underemployment, job displacement, cognitive offloading, and the potential for user manipulation, misinformation or malinformation. They may also complicate legal and risk-assessment frameworks, foster hallucinations, hinder countermeasures against rogue agents, and suffer from the lack of standardized evaluation methods. Enterprise deployment of AI agents has raised contracting concerns related to liability allocation, data ownership rights, and legal accountability. They have also been criticized for being expensive, having a negative impact on internet traffic, and potentially damaging to the environment due to high energy usage. According to Nvidia CEO Jensen Huang, AI agents would require 100 times more computing power than LLMs. There is also the risk of increased political corruption, as AI agents may not question instructions in the same way that humans would. Journalists have described AI agents as part of a push by Big Tech companies to "automate everything". Several of those companies' CEOs stated in early 2025 that they expect AI agents to eventually "join the workforce".
The result of Fourier transformation is a spectrum of the signal at a series of discrete wavelengths. The range of wavelengths that can be used in the calculation is limited by the separation of the data points in the interferogram. The shortest wavelength that can be recognized is twice the separation between these data points. For example, with one point per wavelength of a HeNe reference laser at 0.633 μm (15800 cm−1) the shortest wavelength would be 1.266 μm (7900 cm−1). Because of aliasing, any energy at shorter wavelengths would be interpreted as coming from longer wavelengths and so has to be minimized optically or electronically. The spectral resolution, i.e. the separation between wavelengths that can be distinguished, is determined by the maximum OPD. The wavelengths used in calculating the Fourier transform are such that an exact number of wavelengths fit into the length of the interferogram from zero to the maximum OPD as this makes their contributions orthogonal. This results in a spectrum with points separated by equal frequency intervals. For a maximum path difference d adjacent wavelengths λ1 and λ2 will have n and (n+1) cycles, respectively, in the interferogram. The corresponding frequencies are ν1 and ν2:
Laser microprobe mass spectrometer Particulate matter sampler Aerosol impaction Particle size analysis Hartonen, Kari; Laitinen, Totti; Riekkola, Marja-Liisa (2011). "Current instrumentation for aerosol mass spectrometry". TrAC Trends in Analytical Chemistry. 30 (9): 1486–1496. doi:10.1016/j.trac.2011.06.007. ISSN 0165-9936. Centre for Atmospheric Science TOF-AMS resources Q-AMS resources List of publications using all versions of the AMS Glossary of AMS terms
Sources: en.wikipedia.org
Chromosome 11 open reading frame 91, or C11orf91 is a protein which in humans is encoded by the C11orf91 gene. The C11orf91 gene consists of 5159 nucleotides with an mRNA of approximately 836 base pairs. There is one exon found in the C11orf91 gene. The cytogenetic band location of C11orf91 is 11p13 and is located on the minus strand of the DNA . Annotated depiction of the C11orf91 mRNA and amino acid protein sequences. The C11orf91 gene encodes a protein that is 193 amino acids in length. The C11orf91 protein contains a domain of unknown function, DUF5529, that spans nearly the entire protein. RBMX protein binding sites were found to be highly conserved in several structures of human C11orf91 3'UTR and 5' UTR. C11orf91 is rich in serine and proline and poor in valine and asparagine. There is a proline rich region found in the middle of the C11orf91. The human C11orf91 protein is approximately 20 kDal and has an isoelectric point around 9. Human C11orf91 protein is predicted to be localized in vesicles. C11orf91 has two helices located near the C-terminus and no beta sheets.
=== Nuclear bomb fallout === Bombs in the Arctic area of Novaja Zemlja and bombs detonated in or near the stratosphere released caesium-137 that landed in upper Lapland, Finland. Measurements of caesium-137 in the region in the 1960s were reportedly 45,000 becquerels. Figures from 2011 have a midrange of about 1,100 becquerels, but no increase in cancer cases has been identified.
In Cape Town, for example, the wealthiest 14% of the population use half of the city's water, while the poorest 62% use just a quarter. 11 April – A study reports that genomic surveillance (GS) shows that a clonal lineage of the wheat blast fungus has spread worldwide and that there is a need for GS to track and mitigate the potential pandemic threat to the global food supply as it may become fungicide-insensitive. 13 April The direct imaging of HIP 99770 b, a new exoplanet found 133 light years away, is reported by astronomers. A global trend towards more rapid-onset "flash droughts" hindering forecasting is reported. 14 April Jupiter Icy Moons Explorer (JUICE) is launched by the European Space Agency (ESA) to search for life in the Jovian system, with an expected arrival date of 2031. 17 April A new technique for improving the resolution of post-mortem MRI brain scans "by 64 million times" is reported by researchers, who capture the sharpest ever images of an entire mouse brain. A study expands upon the international Earth heat inventory from 2020, which provides a measure of the Earth energy imbalance (EEI) and allows for quantifying how much and where heat has accumulated in the Earth system with comprehensive data. It suggests that the EEI is the "most fundamental global climate indicator" to gauge climate change mitigation efforts. 18 April Astronomers conclude that "...
There are two types of construction: the series of adjacent buildings in an enclosure around a common, and the round huts with grass roof. The round huts with grass roof architecture are situated in the northern regions, while the series of adjacent buildings are in the southern regions. Postmodern architecture and high-tech architecture buildings are in the southern regions, while heritage sites are evident in the more than 30 forts and castles in the country, such as Fort William and Fort Amsterdam. Ghana has museums that are situated inside castles, and two are situated inside a fort. The Military Museum and the National Museum organise temporary exhibitions. Ghana has museums that allow an in-depth look at specific regions, with a number of museums providing insight into the traditions and history of the geographical areas. The Cape Coast Castle Museum and St. George's Castle (Elmina Castle) Museum offer guided tours. The Museum of Science and Technology provides its visitors with a look into the domain of scientific development.
== False claims == Since around 2008, GcMAF has been promoted as a cure for cancer, HIV, autism and other conditions. Three out of four of the original studies authored by Yamamoto (published between 2007 and 2009) were retracted by the scientific journals in which they were published in 2014, officially due to irregularities in the way ethical approval was granted. Retraction reasons also included methodological errors in the studies. The integrity of the research, conducted by Nobuto Yamamoto and colleagues, that originally prompted claims regarding cancer and HIV has been questioned. The UK Medicines and Healthcare products Regulatory Agency and Cancer Research UK has warned the public about spurious claims of clinical benefits, misleadingly based on reduced levels of the alpha-N-acetylgalactosaminidase enzyme (also known as nagalase), whose production might be increased in many cancers. In 2014 the Belgian Anticancer Fund communicated serious concerns about published studies on GcMAF by Yamamoto and colleagues. In 2015 the UK Medicines and Healthcare products Regulatory Agency (MHRA) closed a factory in Milton, Cambridgeshire owned by David Noakes' company Immuno Biotech that manufactured GcMAF for cancer treatment. In September 2018 Noakes pleaded guilty in UK to manufacturing a medicinal product without a manufacturer's licence, selling or supplying medicinal products without market authorisation, and money laundering, and sentenced to 15 months of jail.
Sources: en.wikipedia.org
Solid product can remain within specification for years when stored dry and sealed, but expiration dates reflect manufacturer testing and regulatory conventions. Moisture and heat increase conversion to creatinine, so storage conditions matter more than the printed date alone. Degradation is gradual and can be monitored by purity testing.
Purity is typically evaluated by chromatographic separation with ultraviolet detection, sometimes supported by spectroscopic identity tests. Moisture and creatinine content are common quality parameters. Results depend on the analytical method, sample preparation, and specification limits.
Clumping occurs when powder absorbs moisture, causing particles to stick together. Humidity, temperature changes, and repeated container opening promote this effect. Clumps do not necessarily indicate chemical degradation, but they can affect weighing and mixing.
In common usage, yes, but technically creatine monohydrate is one specific hydrated salt form. Other creatine forms exist and differ in composition and properties. The monohydrate is the most studied and most widely available grade.